PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04963A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 197aa    MW: 21935.6 Da    PI: 8.8338
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04963AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.4e-074086347
                               SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                               +W++ Ed+ +  a   ++     +W+++a++++ gRt+ +  +++q +
  Oropetium_20150105_04963A 40 PWSKAEDKVFESALVAFPEQvpnRWALVASRLP-GRTAQEAWDHYQAL 86
                               8**************999999999*********.****9988888865 PP

2Myb_DNA-binding46.11.1e-14128172347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  Oropetium_20150105_04963A 128 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 172
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.08E-113388IPR009057Homeodomain-like
PROSITE profilePS512948.0033391IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-73487IPR009057Homeodomain-like
SMARTSM007173.7E-43789IPR001005SANT/Myb domain
CDDcd001671.57E-54087No hitNo description
PfamPF002499.6E-64085IPR001005SANT/Myb domain
PROSITE profilePS5129420.291121177IPR017930Myb domain
SuperFamilySSF466892.37E-18123177IPR009057Homeodomain-like
SMARTSM007179.2E-11125175IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.0E-17125176IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-11127171IPR009057Homeodomain-like
CDDcd001671.11E-11128173No hitNo description
PfamPF002491.4E-11128172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MDYYYGVGGQ SSSSWAAPVG AGGMTMVQQQ QVPPMMMSRP WSKAEDKVFE SALVAFPEQV  60
PNRWALVASR LPGRTAQEAW DHYQALLADV DLIERGMVEV PDAWDEEGRA AGRGRGGGAG  120
DERRRGVPWT EEEHRLFLEG LEKYGRGDWR NISRWSVKTR TPTQVASHAQ KYFIRQASAA  180
TRGDTKRKSI HDITTP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9714055e-87EU971405.1 Zea mays clone 363908 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.14e-95PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-51DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA2Y5554e-95A2Y555_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0PN454e-95A0A0E0PN45_ORYRU; Uncharacterized protein
TrEMBLA0A0D9ZZV14e-95A0A0D9ZZV1_9ORYZ; Uncharacterized protein
TrEMBLQ6F2M64e-95Q6F2M6_ORYSJ; Os05g0442400 protein
STRINGLOC_Os05g37060.11e-94(Oryza sativa Japonica Group)
STRINGBGIOSGA017964-PA1e-94(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-45MYB family protein